DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eogt and AT3G18170

DIOPT Version :9

Sequence 1:NP_001259934.1 Gene:Eogt / 33424 FlyBaseID:FBgn0264672 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001326302.1 Gene:AT3G18170 / 821344 AraportID:AT3G18170 Length:535 Species:Arabidopsis thaliana


Alignment Length:394 Identity:90/394 - (22%)
Similarity:153/394 - (38%) Gaps:95/394 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 CKLN-RTRLSGEMEHIGSAL---------------------------QSWGPEL-RNFDVLPHPV 208
            |:|| ..|:.|:...:.:|:                           :.|..:| :|.|.|.:  
plant   165 CELNGDVRVHGKSATVSAAITFAFSGNSTWHIRPYARKGDTVAMKRVREWTVKLEQNADQLEN-- 227

  Fly   209 LESGLCDVVVNTPTFIMKIDATYNMYHHFCDFFNLYASLFVNQSHPAAFNTDVQILIWETYP-YD 272
            .....|....:.|..|..:.. |:| ::|.||.::...|:.....   ||.:||.|:....| :.
plant   228 ANFSRCVRNHSVPAMIFSLGG-YSM-NNFHDFTDIVIPLYTTARR---FNGEVQFLVTNKSPSWI 287

  Fly   273 SPFRDTFKAFSQRPVWTLSDVEGKRVCFKNVVLPLL-PRMIFGLFYNTPIIQGCSNSGL----FR 332
            :.|::..:..|...|..: |.|.:..||.:|.:.|. .|..|......|     |||..    ||
plant   288 NKFKELVRKLSNYEVIYI-DEEDETHCFSSVTVGLTRHREYFKELTIDP-----SNSEYSMSDFR 346

  Fly   333 AF--------SEFILHRLQIPYKPPQQKIRITYLSRRTKYRQVLNEDELL-APLEANDKYDVQRV 388
            :|        ::.:..| ||..:.|    ||..|: |.:.|..:|..|:. |..:...|..|...
plant   347 SFLRDTYSLRNDAVATR-QIRRRRP----RILILA-RGRSRAFVNTGEIARAARQIGFKVVVAEA 405

  Fly   389 SYERLPFTNQLAITRNTDILIGMHGAGLTHLLFLPNWACIFELY-----------NCEDPNCYKD 442
            :.....|...:   .:.|:::|:||||||:::|||..|.:.::.           :.|.|:   :
plant   406 NIGIAKFAQTV---NSCDVMLGVHGAGLTNMVFLPENAVVIQVLPIGGFEWLAKTDFEKPS---E 464

  Fly   443 LARLRGVRYR-TWEQRDLV--YPQDEGHHPEGGAHAKF------------TNYSFDVKEFVHLVD 492
            ...||.:.|: ..|:..||  |.:|.....:..|.||.            .|.|.|:..|..::.
plant   465 GMNLRYLEYKIAVEESTLVKKYGRDHEIVRDPSAVAKHGWEMFKSVYLVQQNVSIDINRFKPVLV 529

  Fly   493 GAAE 496
            .|.|
plant   530 KALE 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EogtNP_001259934.1 DUF563 232..454 CDD:282442 61/248 (25%)
AT3G18170NP_001326302.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4625
eggNOG 1 0.900 - - E1_KOG4698
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D567582at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1388
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.