DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eogt and AT2G41640

DIOPT Version :9

Sequence 1:NP_001259934.1 Gene:Eogt / 33424 FlyBaseID:FBgn0264672 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_565952.1 Gene:AT2G41640 / 818762 AraportID:AT2G41640 Length:500 Species:Arabidopsis thaliana


Alignment Length:365 Identity:85/365 - (23%)
Similarity:139/365 - (38%) Gaps:113/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 LCDVVVNTP-TFIMKIDATYNMYHHFCDFFNLYASLFVNQSHPAAFNTDVQILIWETYP-YDSPF 275
            :|||..:.| .|......|.|:||.|.|..   ..||:...|   :|..|..:|.|.:. ::..:
plant   174 VCDVYHDVPAVFFSTGGYTGNVYHEFNDGI---IPLFITSQH---YNKKVVFVIVEYHDWWEMKY 232

  Fly   276 RDTFKAFSQRPVWTLSDVEG--KRVCFKNVVLPLLPRMIFGLFYNTPIIQGCS-----NSGLFRA 333
            .|.....|..|   |.|..|  :..|||...:.|  |:...|..|:.::.|..     .:.|.|.
plant   233 GDVVSQLSDYP---LVDFNGDTRTHCFKEATVGL--RIHDELTVNSSLVIGNQTIVDFRNVLDRG 292

  Fly   334 FSEFILHRLQ-------------IPYKPPQQKIRITYLSRRTKYRQVLNEDELLAPLEANDKYDV 385
            :|    ||:|             :.:|   :|.::..|||....|.:|||: ||..|.....::|
plant   293 YS----HRIQSLTQEETEANVTALDFK---KKPKLVILSRNGSSRAILNEN-LLVELAEKTGFNV 349

  Fly   386 QRVSYERLPFTNQLA-ITRN---TDILIGMHGAGLTHLLFL-------------PNWAC------ 427
            :.:..::   |.::| |.|:   :|::||:|||.:||.|||             .:||.      
plant   350 EVLRPQK---TTEMAKIYRSLNTSDVMIGVHGAAMTHFLFLKPKTVFIQIIPLGTDWAAETYYGE 411

  Fly   428 --------------------IFELYNCEDPNCYKDLARLRGVRYRTWEQRDLVYPQDEGHHPEGG 472
                                ::|.|..:|| ..:|...|..   :.||....:|.|.:       
plant   412 PAKKLGLKYVGYKIAPKESSLYEEYGKDDP-VIRDPDSLND---KGWEYTKKIYLQGQ------- 465

  Fly   473 AHAKFTNYSFDVKEFVHLVDGA---------AEEILSHKE 503
                  |...|::.|...:..:         .|:.|.|:|
plant   466 ------NVKLDLRRFRETLTRSYDFSIRRRFREDYLLHRE 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EogtNP_001259934.1 DUF563 232..454 CDD:282442 68/285 (24%)
AT2G41640NP_565952.1 DUF563 <315..424 CDD:282442 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4625
eggNOG 1 0.900 - - E1_KOG4698
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D567582at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3900
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1388
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.