DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eogt and AT2G03370

DIOPT Version :9

Sequence 1:NP_001259934.1 Gene:Eogt / 33424 FlyBaseID:FBgn0264672 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001325194.1 Gene:AT2G03370 / 814866 AraportID:AT2G03370 Length:454 Species:Arabidopsis thaliana


Alignment Length:317 Identity:70/317 - (22%)
Similarity:115/317 - (36%) Gaps:87/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDA-TYNMYHHFCDFFNLYASLFV--NQSHPAAF 257
            |.:|...:...|:.....||:..:.|..:..... |.::||...|.|   ..||:  |..:|   
plant   124 PRIRELTLTSGPLGLPRSCDITHDLPAIVFSAGGYTGSIYHDLMDGF---IPLFITANSVYP--- 182

  Fly   258 NTDVQILIWETYPYDSP-FRDTFKAFSQRPVWTLSDVEGKRV--CFKNVVLPLLPRMIFGL---- 315
            :.|...::.....:..| :.|....||:.....|.|.|....  ||.:.::.|:......:    
plant   183 DRDFIPVVVNAKEWWMPKYIDILGTFSKHKPILLLDKESVATTHCFTSAIVGLITHWPMTIDPTQ 247

  Fly   316 ---------FYNTPIIQGCSNSGLFRAFSEFILHRLQIPYKPPQQKIRITYLSRRTKY-RQVLNE 370
                     |:|.          |.:||:..|       ..|...|.|:..:||.... |.:|||
plant   248 IPNSKSLVDFHNL----------LEKAFTTNI-------STPKTHKPRLMLVSRYGNIGRVILNE 295

  Fly   371 DELLAPLEANDKYDVQRVSYERLPF-----TN---QLAITRNTDILIGMHGAGLTHLLFLP---- 423
            .|:...||        .|.:|.:.|     ||   ...:.:::..::|:|||.|||||||.    
plant   296 QEIKEMLE--------DVGFEVIIFRPSKTTNLKEAYKLIKSSHGMVGVHGAALTHLLFLRPGSI 352

  Fly   424 ---------NWACIFELYNCEDPNCYKDLARLRGVRYRTW----EQRDLV--YPQDE 465
                     .||         ...||:..|:...:.|..:    |:..|:  |.:|:
plant   353 FVQVVPLGLGWA---------SKPCYESPAKTMKLEYLEYKVNVEESSLIEKYNRDD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EogtNP_001259934.1 DUF563 232..454 CDD:282442 59/261 (23%)
AT2G03370NP_001325194.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4625
eggNOG 1 0.900 - - E1_KOG4698
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D567582at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1388
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.