DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eogt and AT2G03360

DIOPT Version :9

Sequence 1:NP_001259934.1 Gene:Eogt / 33424 FlyBaseID:FBgn0264672 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001118256.1 Gene:AT2G03360 / 814865 AraportID:AT2G03360 Length:455 Species:Arabidopsis thaliana


Alignment Length:306 Identity:67/306 - (21%)
Similarity:122/306 - (39%) Gaps:57/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QSW-GPELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDA-TYNMYHHFCDFFNLYASLFV--NQS 252
            ::| .|.:|...:...|...:..||:..::|..:..... |.::||.|.|.|   ..||:  |..
plant   121 ENWIMPRIRELKLTSGPSDLTRSCDITHDSPAIVFSAGGYTGSIYHDFIDGF---IPLFITANSV 182

  Fly   253 HPAAFNTDVQILIWETYPYDSP-FRDTFKAFSQRPVWTLSDVEGKRV--CFKNVVLPLLPRMIFG 314
            :|   :.|..:::.....:..| :.|....||:... .|.|.|...:  ||.:..:        |
plant   183 YP---DRDFILVVVNPKEWWMPKYIDILGTFSKHKT-ILLDKENASITHCFTSATV--------G 235

  Fly   315 LFYNTPIIQGCSNSGLFRAFSEFILHRLQIPYKPPQ------QKIRITYLSRRTKY-RQVLNEDE 372
            |..:.|:....:.....::..:|  |.|......|.      .|.|:..:.|.... |.:|||:|
plant   236 LISHGPMTIDPTQIPNSKSLVDF--HNLLDKALNPNLSIIKINKPRLILVRRYGNIGRVILNEEE 298

  Fly   373 LLAPLEANDKYDVQRVSYERLPF----TNQL----AITRNTDILIGMHGAGLTHLLFLPNWACIF 429
            :...||        .|.:|.:.|    |..|    .:.:::..:||:|||.||.||||...:.:.
plant   299 IREMLE--------DVGFEVITFRPSKTTSLREAYKLIKSSHGMIGVHGAALTQLLFLRPGSVLV 355

  Fly   430 EL----YNCEDPNCYKDLARLRGVRYRTW----EQRDLV--YPQDE 465
            ::    .......|::..|:...:.|..:    |:..|:  |.:|:
plant   356 QIVPVGLGWVSKTCFETPAKAMKLDYTEYRVNVEESSLIEKYSRDD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EogtNP_001259934.1 DUF563 232..454 CDD:282442 55/245 (22%)
AT2G03360NP_001118256.1 DUF563 164..359 CDD:282442 52/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4625
eggNOG 1 0.900 - - E1_KOG4698
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D567582at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20961
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1388
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.