DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eogt and pomgnt2

DIOPT Version :9

Sequence 1:NP_001259934.1 Gene:Eogt / 33424 FlyBaseID:FBgn0264672 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001012384.2 Gene:pomgnt2 / 497644 ZFINID:ZDB-GENE-050522-242 Length:585 Species:Danio rerio


Alignment Length:498 Identity:127/498 - (25%)
Similarity:198/498 - (39%) Gaps:89/498 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KQQLPTNLTG--KGTISSACWGHERDCTPAGRFQTPQCPGEHTGWARSKE-AQVRTFYNQADFGY 107
            :..||..|.|  ...:::..|.:.|...     .|.|...|.....:|:| :|||..|:.|... 
Zfish     7 RMNLPAVLNGLLVSVVAALLWKYVRLVE-----HTSQLEEELQLTRQSQEFSQVRIDYHGALLA- 65

  Fly   108 IQEQLSQLTPQCVPTYLGDSSLECT---HYLRFCRGRNLLFDFR-GLEQREERIRYHMD--VLGP 166
            :||..:::.              ||   |..|.||     ||:. ...:.||.:.:|.:  |:.|
Zfish    66 LQEHGTRMV--------------CTGKMHTDRICR-----FDYLCYCTEAEEFVFFHSNASVMLP 111

  Fly   167 GQLLGHCKLNRTRLSGEMEHIGSALQSWGPELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDATY 231
            .  ||..:.....|.      .|:::....:..||..||...|:.....|.|...|.|:......
Zfish   112 N--LGSRRFQPALLD------LSSVEDHNTQYFNFLELPAAALKFMPKPVFVPDVTLILNRFNPD 168

  Fly   232 NMYHHFCDFFNLYASLFVNQSHPAAFNTDVQILIWETYPYDSPFRDTFKAF-SQRPVWTLSD--- 292
            |:.|.|.|  :|....:..|.: :..:.:.:::..|.:...:.| |.::.. |::|:  |.|   
Zfish   169 NLMHIFHD--DLLPVYYTMQQY-SDLDDEARLVFMEGWGEGAHF-DLYRLLSSKQPL--LKDQLK 227

  Fly   293 VEGKRVCFKNVVLPLLPRMIFGLFYNTPIIQGCSNSGL-----FRAFSEFILHRLQIPYKPPQQK 352
            ..||.:||....:. |.:|.....|.....||...:.|     .|.|:.|::.||.|..:..::.
Zfish   228 TFGKLMCFTKSYVG-LSKMTTWYQYGFVQPQGPKANILISGNEIRQFASFLMERLNITREEEEED 291

  Fly   353 IRITYLSRRTKYRQVLNEDELLAPLEANDKYDVQRVSYERLPFTNQLAITRNTDILIGMHGAGLT 417
            .....:.:||..|.:|||.|||..|....:.....||.|...|.|.:.|.....:|:.||||.:.
Zfish   292 DDYIVVFKRTTNRLILNEAELLLALAQEFQMRTVTVSLEEQSFDNIIQIISRAAMLVSMHGAQMI 356

  Fly   418 HLLFLPNWACIFELY----NCEDPNCYKDLARLRG--VRYRTW----EQRDLVYPQDEGHHP--E 470
            ..:|||..|.:.||:    |.|....||.||.|.|  ::|..|    |:..:.:|.    .|  :
Zfish   357 TSMFLPRGAAVVELFPYGVNPEQYTPYKTLASLPGMDLQYVAWRNTMEENTVTFPD----RPWDQ 417

  Fly   471 GGAHAKFTNYSFDVKEFVHLVDGAAEEILSHKEFPRR-ASENP 512
            ||              .|||.....|.||:.||.||. ...||
Zfish   418 GG--------------IVHLEKEEQERILASKEVPRHLCCRNP 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EogtNP_001259934.1 DUF563 232..454 CDD:282442 65/236 (28%)
pomgnt2NP_001012384.2 DUF563 <326..402 CDD:301702 27/75 (36%)
FN3 498..585 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.