DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eogt and Pomgnt2

DIOPT Version :9

Sequence 1:NP_001259934.1 Gene:Eogt / 33424 FlyBaseID:FBgn0264672 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001009437.1 Gene:Pomgnt2 / 316091 RGDID:1304827 Length:580 Species:Rattus norvegicus


Alignment Length:413 Identity:101/413 - (24%)
Similarity:160/413 - (38%) Gaps:60/413 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GDSSLEC---THYLRFCRGRNLLFDFRGLEQREERIRYH--MDVLGPGQLLGHCKLNRTRLSGEM 184
            |.:.:.|   ||..|.||.:.|.:.    .:.||.|.:|  ..|:.|.  ||..:.....|.   
  Rat    63 GGTHMVCTGRTHTDRICRFKWLCYS----NEAEEFIFFHGNSSVMLPN--LGSRRFQPALLD--- 118

  Fly   185 EHIGSALQSWGPELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDATYNMY------HHFCDFFNL 243
               .|.::....:..||..||...|.      .:..|.|:..:....|.:      |.|.|  :|
  Rat   119 ---LSTVEDHNAQYFNFVELPAAALR------FMPKPVFVPDVALIANRFNPDNLMHVFHD--DL 172

  Fly   244 YASLFVNQSHPAAFNTDVQILIWETYPYDSPFRDTFKAFSQRPVWTLSDVE--GKRVCFKNVVLP 306
            ....:..:..| ....:.::...|.:...:.| |.:|..|.:.....|.::  |:.:||.:..:.
  Rat   173 LPLFYTLRQFP-GLAQEARLFFMEGWGEGAHF-DLYKLLSPKQPLLRSQLKTLGRLLCFSHAFVG 235

  Fly   307 LLPRMIFGLFYNTPIIQGCSNSGL-----FRAFSEFILHRLQIPYKPPQQKIRITYLSRRTKYRQ 366
             |.::.....|.....||...:.|     .|.|:.|:..||.:.:...........:..||:.|.
  Rat   236 -LSKVTTWYQYGFVQPQGPKANILVSGNEIRQFTRFMTERLNVSHAGAPLGEEYILVFSRTQNRL 299

  Fly   367 VLNEDELLAPLEANDKYDVQRVSYERLPFTNQLAITRNTDILIGMHGAGLTHLLFLPNWACIFEL 431
            :|||.|||..|....:.....||.|...|.:.:.:..|..:|:.||||.|...||||..|.:.||
  Rat   300 ILNEAELLLELAQEFQMKTVTVSLEDHTFADVVRLVSNASMLVSMHGAQLVTALFLPRGATVVEL 364

  Fly   432 Y----NCEDPNCYKDLARLRG--VRYRTWEQRDLVYPQDEGHHPEGGAHAKFTNYSFDVKEFVHL 490
            :    |.:....||.||.|.|  ::|..|  |::: .::...|||         ..:|.....||
  Rat   365 FPYAVNPDHYTPYKTLATLPGMDLQYVAW--RNMI-RENTVTHPE---------RPWDQGGITHL 417

  Fly   491 VDGAAEEILSHKEFPRR-ASENP 512
            .......||..:|.||. ...||
  Rat   418 DRAEQARILQSREVPRHLCCRNP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EogtNP_001259934.1 DUF563 232..454 CDD:282442 61/240 (25%)
Pomgnt2NP_001009437.1 DUF563 <320..395 CDD:417760 27/76 (36%)
FN3 493..580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4698
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.