DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and Mterf4

DIOPT Version :9

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_835152.1 Gene:Mterf4 / 69821 MGIID:1918355 Length:346 Species:Mus musculus


Alignment Length:278 Identity:61/278 - (21%)
Similarity:118/278 - (42%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PKILQLEQI------------HIDEAIKIEPT------LAVFSPEIWRRAHQTFQNHGLETVNFL 74
            |:.|:.|::            ||.....|:|:      |.:.|..:..         ||......
Mouse    87 PESLEPEKVIRSLQDMGFAEAHIHSLFSIQPSVHPQQLLGIVSELLLL---------GLNPEPVF 142

  Fly    75 RIVTGNPAILKRTPDKIISCLEIWRACQF------GENLLHLLLTKYPELLDVSDSHQ--LLSHI 131
            ..:..||.:||      :|.:::.|...:      ||..|..:|:..||:..:   ||  :...:
Mouse   143 NALKKNPQLLK------LSSMQMKRRSSYLRKLGLGEGKLKRVLSVCPEVFTM---HQRDIDRVV 198

  Fly   132 GFLQSR-VSTSKNVWKCLMNSPDLIAQSEVSIEEKLNFITDVMRIEVPELVKSAALTLSFEELRC 195
            ..|:.: :.|::::...|...|.::.:....:|.|..:....|.:...::|::..|..|..:::.
Mouse   199 KVLREKCLFTAQHITDVLHRCPTVLQEDPNELEYKFQYAYFRMGLTHLDIVRTNFLQYSITKIKQ 263

  Fly   196 RHQFLLRLGLFKPRPPKADPNEPTTNPKLYQITDTSEKSFATKICHVTLPEYEAFKDLYAKELEQ 260
            ||.:|.|||.::....|.....|  ||.|..|...||..|..:....::.|::.||.|..:|.|:
Mouse   264 RHIYLERLGRYQTPDKKGQTQIP--NPSLRNILRVSEAEFLARTACSSVEEFQVFKKLLDQEEEE 326

  Fly   261 KSR---RKEEDELSDEDD 275
            :|.   .:||:|..:|::
Mouse   327 ESESHASEEEEEEEEEEE 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 29/138 (21%)
Mterf4NP_835152.1 mTERF <128..302 CDD:327630 41/193 (21%)
MTERF 1 142..172 6/35 (17%)
MTERF 2 177..204 6/29 (21%)
MTERF 3 209..239 4/29 (14%)
MTERF 4 245..270 6/24 (25%)
MTERF 5 290..318 7/27 (26%)
Dimerization with NSUN4. /evidence=ECO:0000250 310..327 6/16 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..346 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29YX2
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109637
Panther 1 1.100 - - O PTHR13068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4039
SonicParanoid 1 1.000 - - X5409
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.