DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and mter-4

DIOPT Version :9

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001021568.2 Gene:mter-4 / 3565891 WormBaseID:WBGene00010771 Length:348 Species:Caenorhabditis elegans


Alignment Length:245 Identity:67/245 - (27%)
Similarity:107/245 - (43%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ILQLEQIHIDEAIKIEPTLAVFSPEIWRRAHQTFQNHGLETVNFLRIVTGNPAILKRTPDKIISC 94
            |:.:..:..::||::   ||:|..::.|.                    |:|:|.|.        
 Worm   109 IVNVGYVTFEDAIRL---LALFPDDLLRH--------------------GSPSITKN-------- 142

  Fly    95 LEIWRACQFG-ENLLHLLLTKYPELLDVSDSHQL--LSH-IGFLQSRVSTSKNVWKCLMNSPDLI 155
            :|...||... ...:...:.|.|.||...|..::  |:| ||...||......:.:|    |.::
 Worm   143 IEALSACGISTPRTIGSAIKKCPPLLFARDPQEMQRLAHEIGGFFSRKQAGHLISRC----PQIL 203

  Fly   156 AQSEVSIEEKLNFITDVMRIEVPELVKSAAL--TLSFEELRCRHQFLLRLGLFKPRPPKADPNEP 218
            .:....||||..::...|.:|..::.:....  .|:|:|:..||:|||..|.| ..|....|...
 Worm   204 LKPIEEIEEKYEYMFYQMGVEADDVAECIGWIDILTFDEIVDRHKFLLATGKF-ATPDAKRPQIR 267

  Fly   219 TTNPKLYQITDTSEKSFATKICHVTLPEYEAFKDLYAKE-LEQKSRRKEE 267
            ..||||..|.|:.|:.||.|:..||:.|:..||.|..|| :.:|..||.|
 Worm   268 IENPKLQSILDSKEEDFAVKVARVTMEEWIVFKALRVKETINEKKERKFE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 34/135 (25%)
mter-4NP_001021568.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167739
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29YX2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I3920
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006444
OrthoInspector 1 1.000 - - oto20126
orthoMCL 1 0.900 - - OOG6_109637
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4039
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.