DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3609 and AT3G20790

DIOPT Version :9

Sequence 1:NP_001188684.1 Gene:CG3609 / 33421 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_188715.2 Gene:AT3G20790 / 821627 AraportID:AT3G20790 Length:355 Species:Arabidopsis thaliana


Alignment Length:202 Identity:51/202 - (25%)
Similarity:95/202 - (47%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GIASAGK---ISEDFVIALSTLPSSDHKVQAVAARALDRAQ---EFATKHGIPKAL------GSY 60
            |||..|.   :...::..|:.: |....::|:.:|..:.|:   |.|.|| .|:..      |..
plant     8 GIAILGAGIFVKTQYIPRLAEI-SDLVDLKAIWSRTEESAKGAVEIARKH-FPEVKCKWGDEGLN 70

  Fly    61 EELAKSTDVDVVYIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEA 125
            |.:..|:.|.|..:...... .|::|.||..|||||.|||.|.:..::|   .|..:.:....::
plant    71 EIIQDSSIVGVAVVVAAETM-VELSLKMLKAGKHVLQEKPAAASISEIE---TAMSSYRNISADS 131

  Fly   126 ----VWS-----RFFPSYQRVKELISSGQLGQVKDVEV----NFGFPMPHVDRLQKRELGGGVVY 177
                :|:     ||.|::..:|:||:  ::|.:.:|::    :.....|:.....:|.|.||.:.
plant   132 PCRPIWAVAENYRFEPAFVELKKLIA--EIGDMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGFIL 194

  Fly   178 DLGIYTI 184
            |:|::.|
plant   195 DMGVHYI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 51/202 (25%)
GFO_IDH_MocA 5..123 CDD:279716 34/126 (27%)
GFO_IDH_MocA_C 138..>198 CDD:304482 13/51 (25%)
AT3G20790NP_188715.2 MviM 9..352 CDD:223745 50/201 (25%)
NADB_Rossmann 9..118 CDD:304358 31/111 (28%)
GFO_IDH_MocA_C 153..>239 CDD:304482 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.