Sequence 1: | NP_001188684.1 | Gene: | CG3609 / 33421 | FlyBaseID: | FBgn0031418 | Length: | 335 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_188715.2 | Gene: | AT3G20790 / 821627 | AraportID: | AT3G20790 | Length: | 355 | Species: | Arabidopsis thaliana |
Alignment Length: | 202 | Identity: | 51/202 - (25%) |
---|---|---|---|
Similarity: | 95/202 - (47%) | Gaps: | 33/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GIASAGK---ISEDFVIALSTLPSSDHKVQAVAARALDRAQ---EFATKHGIPKAL------GSY 60
Fly 61 EELAKSTDVDVVYIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEA 125
Fly 126 ----VWS-----RFFPSYQRVKELISSGQLGQVKDVEV----NFGFPMPHVDRLQKRELGGGVVY 177
Fly 178 DLGIYTI 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3609 | NP_001188684.1 | MviM | 5..292 | CDD:223745 | 51/202 (25%) |
GFO_IDH_MocA | 5..123 | CDD:279716 | 34/126 (27%) | ||
GFO_IDH_MocA_C | 138..>198 | CDD:304482 | 13/51 (25%) | ||
AT3G20790 | NP_188715.2 | MviM | 9..352 | CDD:223745 | 50/201 (25%) |
NADB_Rossmann | 9..118 | CDD:304358 | 31/111 (28%) | ||
GFO_IDH_MocA_C | 153..>239 | CDD:304482 | 13/51 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0673 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |