DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3609 and blvra

DIOPT Version :9

Sequence 1:NP_001188684.1 Gene:CG3609 / 33421 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001070069.1 Gene:blvra / 767661 ZFINID:ZDB-GENE-060929-312 Length:292 Species:Danio rerio


Alignment Length:158 Identity:40/158 - (25%)
Similarity:67/158 - (42%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDVDVV 72
            ||..||.:....::|    |.|....:.::.|.....:....:.|: |.:...|.|::. |:.|.
Zfish     8 GIGIAGSVRMRDLMA----PLSSSAAEQISIRGFVSRRSLEDQQGV-KQISMTEALSRD-DIHVA 66

  Fly    73 YIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEAVWSRFFPSYQRV 137
            :|.|.|..|.|.....|..||||..|.|:.::......:...|:.......|.....|.|.::::
Zfish    67 FICTENTSHEENIRQFLEAGKHVCVEYPMTLSHTSAVDLWNLAQQKGLVLHEEHIELFTPDFKQL 131

  Fly   138 KELISSGQLGQVK------DVEVNFGFP 159
            |:.||...|.:.|      .::.|||||
Zfish   132 KKDISGKTLEEGKLHFTGGPLKANFGFP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 40/158 (25%)
GFO_IDH_MocA 5..123 CDD:279716 27/114 (24%)
GFO_IDH_MocA_C 138..>198 CDD:304482 10/28 (36%)
blvraNP_001070069.1 MviM 1..>146 CDD:223745 35/143 (24%)
GFO_IDH_MocA 5..120 CDD:279716 28/117 (24%)
Biliv-reduc_cat 128..237 CDD:286275 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.