DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3609 and GFOD1

DIOPT Version :9

Sequence 1:NP_001188684.1 Gene:CG3609 / 33421 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_061861.1 Gene:GFOD1 / 54438 HGNCID:21096 Length:390 Species:Homo sapiens


Alignment Length:367 Identity:82/367 - (22%)
Similarity:144/367 - (39%) Gaps:93/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDVDVVYIGTLNPQHYEVA 85
            :.:..|......|:|:..|..:.|:|.|.:..:|......:|:....|||:|.|....|...::|
Human    16 VIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIA 80

  Fly    86 LLMLNNGKHVLCEK---PLAMNKKQVEGILAAAKANKRFFMEAVWS------RFFPSYQRVKELI 141
            :..|..||:|:|::   ||.          |....:...:...:.|      ||.|::.|:|:||
Human    81 VKTLGIGKNVICDRTATPLD----------AFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLI 135

  Fly   142 SSGQLGQ--VKDVEVNFGFPMPHVDRLQKRE-------LGGGVVYDLGIYTIQVSQWAFQEKPEK 197
            ..|.:|:  |.:|:|:.|      ..|.|:.       :|||.::.:|.|.|.:..:...:|..|
Human   136 EEGYVGEPLVCEVQVHGG------SLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVK 194

  Fly   198 IES------KGTLNAEGI-----DDDVSATLTYSGG--RTARMRFSSKEKLGNTAVIKGTKGQVT 249
            :..      |.|.:.:||     ||..:..:...||  .|..:.|:...:......:.|:.|::.
Human   195 VHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLL 259

  Fly   250 LIDFWSPNKLIDIDGQ-----EKEWLPPKGKYATNYANS-------------------EAMRYEA 290
            .:.       .|:.||     |:|.|.   :.||..:||                   :.|    
Human   260 AVG-------TDLYGQRNSAPEQELLV---QDATPVSNSLLPEKAFSDIPSPYLRGTIKMM---- 310

  Fly   291 EAVRQSI--------IAGEVENKNVTYADSLIFAEIEDTIRK 324
            :||||:.        ..|.......|:.|.|....:.|||::
Human   311 QAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 71/325 (22%)
GFO_IDH_MocA 5..123 CDD:279716 24/104 (23%)
GFO_IDH_MocA_C 138..>198 CDD:304482 18/68 (26%)
GFOD1NP_061861.1 MviM 5..363 CDD:223745 82/367 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.