DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3609 and blvra

DIOPT Version :9

Sequence 1:NP_001188684.1 Gene:CG3609 / 33421 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001006896.1 Gene:blvra / 448743 XenbaseID:XB-GENE-1007964 Length:290 Species:Xenopus tropicalis


Alignment Length:245 Identity:58/245 - (23%)
Similarity:98/245 - (40%) Gaps:76/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GIASAGKISEDFVIALSTLPSSDHK-VQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDVDV 71
            |||.:.:| .|.:..|.:.||...| :..|:.|.||   :|.....|     ..:|..||.|:|.
 Frog    10 GIAGSMRI-RDLLNPLQSSPSESLKLIGFVSRRKLD---QFNNAKQI-----ELDEALKSKDIDA 65

  Fly    72 VYIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEAVWSRFFPSYQR 136
            .:|.|.|..|.|.....|..|||||.|.|:|::                  .||.:..:     |
 Frog    66 AFICTDNQNHEESVRHFLEVGKHVLVEYPMALS------------------AEAAYDLW-----R 107

  Fly   137 VKELISSGQLGQVKDVEVNFGFPMPHVDRLQKRELGGGVVYDLGIYTIQVSQWAFQEKPEKIESK 201
            :.|     |.|:|..||        |::.|.::                     :::..::::.|
 Frog   108 LAE-----QKGKVLHVE--------HIELLTEQ---------------------YKQLKKEVQGK 138

  Fly   202 ----GTLNAEG--IDDDVSATLTYSGGRTARMRFSSKEKLGNTAVIKGTK 245
                |.|:..|  :|:::|...::||  .||:.: ..:..|:..|...|:
 Frog   139 KLVEGVLHFTGGHLDENLSGFPSFSG--IARLSW-LVDLFGDLIVTSATR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 58/245 (24%)
GFO_IDH_MocA 5..123 CDD:279716 34/115 (30%)
GFO_IDH_MocA_C 138..>198 CDD:304482 8/59 (14%)
blvraNP_001006896.1 GFO_IDH_MocA 2..118 CDD:366622 41/144 (28%)
Biliv-reduc_cat 128..240 CDD:370334 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.