DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3597 and AT1G34200

DIOPT Version :9

Sequence 1:NP_001259930.1 Gene:CG3597 / 33420 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_564441.1 Gene:AT1G34200 / 840319 AraportID:AT1G34200 Length:352 Species:Arabidopsis thaliana


Alignment Length:237 Identity:60/237 - (25%)
Similarity:104/237 - (43%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VVAVADVDG-QRAQQFAQRNQIP---RHYDGFDALALDREVEVVYVGTLNPFHYAVVHLMLARGK 95
            :.|:|.... :.|:.||:.|..|   :.:..:::|..|.:|:.||.......|.....|...:||
plant    33 ISAIATTSSIEEAKSFAKSNNFPPNTKLHSSYESLLEDPDVDAVYFPIPTRLHVEWATLAAIKGK 97

  Fly    96 NVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNSMWSRFFPSYDRLRELLKNDV--IGEVTQVKV 158
            ::|.:.|:.|:|.:..::....|..||..|:| :.|.. .|..|:::|.: ||:  .|::..|..
plant    98 HILLDKPVALNVAEFDQIVEACEVNGVQFMDG-TQWMH-SPRTDKIKEFV-NDLESFGQIKSVYS 159

  Fly   159 QHGFR-----LAHMERVCNRSLGGSILMDIGIYALQLGQFV--FGVSPVKILPSGTQLNKERVDV 216
            ...|.     |.|..||.....|...|.|.|.|.:|....|  |.:.......||:.||...:.:
plant   160 CFSFAASDDFLKHDIRVKPGLDGLGALGDAGWYTIQAILLVNNFKLPKTVTALSGSVLNDAGIVL 224

  Fly   217 QIDFMLDYGDGRRLVALVTGLENLENDAVITGTKGEIKLSNY 258
            ....:.|:.||.......:.|.||..:....||||.:::.::
plant   225 SCGALFDWEDGVNATIYCSFLANLTMEITAIGTKGSLRVHDF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 60/237 (25%)
GFO_IDH_MocA 7..127 CDD:279716 24/95 (25%)
GFO_IDH_MocA_C 142..228 CDD:304482 24/94 (26%)
AT1G34200NP_564441.1 MviM 6..342 CDD:223745 60/237 (25%)
GFO_IDH_MocA 7..127 CDD:279716 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I3394
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2178
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D943656at2759
OrthoFinder 1 1.000 - - FOG0001373
OrthoInspector 1 1.000 - - mtm1036
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X868
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.