DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3597 and GFOD1

DIOPT Version :9

Sequence 1:NP_001259930.1 Gene:CG3597 / 33420 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_061861.1 Gene:GFOD1 / 54438 HGNCID:21096 Length:390 Species:Homo sapiens


Alignment Length:367 Identity:80/367 - (21%)
Similarity:143/367 - (38%) Gaps:78/367 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VTALGTVEKSRHVVVAVADVDG-----------QRAQQFAQRNQIPRHYDGFDALALDREVEVVY 75
            |...||...:|.::..:.| :|           :.|::.|:...:|.:....|.:.|.::|::|.
Human     5 VGVFGTSLTARVIIPLLKD-EGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVC 68

  Fly    76 VGTLNPFHYAVVHLMLARGKNVLCE---TPM-CLSVEQAKELYTLAEQRGVFLMEGNSMWSRFFP 136
            :....|....:....|..||||:|:   ||: ...:..|...|.     .:..:.||.:  ||.|
Human    69 INLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYP-----KLMSIMGNVL--RFLP 126

  Fly   137 SYDRLRELLKNDVIGE--VTQVKVQHGFRLAHMER-VCNRSLGGSILMDIGIYALQLGQFVFGVS 198
            ::.|:::|::...:||  |.:|:|..|..|..... .|:..:||..|..:|.|.:.|..|:.|..
Human   127 AFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQK 191

  Fly   199 PVK-------------------------------ILPSG----TQLNKERVDVQIDFMLD---YG 225
            .||                               :|..|    ..||   .:|..:|..|   .|
Human   192 AVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLN---FNVPGEFKQDVTVVG 253

  Fly   226 DGRRLVALVTGLENLENDAVITGTKGEIKLSNYWCCTQISRSNAPPESW---PLPRAKFDFHYTN 287
            ...||:|:.|.|....|.|    .:.|:.:.:   .|.:|.|..|.:::   |.|..:.......
Human   254 SAGRLLAVGTDLYGQRNSA----PEQELLVQD---ATPVSNSLLPEKAFSDIPSPYLRGTIKMMQ 311

  Fly   288 TCGLRYEAEEVRRCIEKRLLESPKFTHAESLELAAIADEIRR 329
            .....::.::.||..:.|.| :...|..:.|....:.|.|:|
Human   312 AVRQAFQDQDDRRTWDGRPL-TMAATFDDCLYALCVVDTIKR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 80/367 (22%)
GFO_IDH_MocA 7..127 CDD:279716 24/119 (20%)
GFO_IDH_MocA_C 142..228 CDD:304482 27/126 (21%)
GFOD1NP_061861.1 MviM 5..363 CDD:223745 80/367 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.