DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3597 and gfod1

DIOPT Version :9

Sequence 1:NP_001259930.1 Gene:CG3597 / 33420 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_012819881.1 Gene:gfod1 / 394777 XenbaseID:XB-GENE-947602 Length:404 Species:Xenopus tropicalis


Alignment Length:283 Identity:63/283 - (22%)
Similarity:111/283 - (39%) Gaps:61/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VTALGTVEKSRHVVVAVADVDG-----------QRAQQFAQRNQIPRHYDGFDALALDREVEVVY 75
            |...||...||.::..:.| :|           :.|::.|:...:|.:.:..|.:.|.::|::|.
 Frog     5 VGVFGTSLTSRVIIPLLKD-EGFSVKALWGRTQEEAEELAKEMSVPFYTNRIDDVLLHQDVDLVC 68

  Fly    76 VGTLNPFHYAVVHLML--------------ARGKNVLCE---TPM-CLSVEQAKELYTLAEQRGV 122
            :....|....:....|              ..||||:|:   ||: ...:..|...|.     .:
 Frog    69 INLPPPLTKQIAVKTLEGQETEDRNENGSTGIGKNVICDRTATPLDAFRMMSAAHYYP-----KL 128

  Fly   123 FLMEGNSMWSRFFPSYDRLRELLKNDVIGE--VTQVKVQHGFRLAHMER-VCNRSLGGSILMDIG 184
            ..:.||.:  ||.|::.::::|::...:||  |.:|:|..|..|..... .|:..:||..|..:|
 Frog   129 MSIMGNVL--RFLPAFVKMKQLIQEGYVGELQVCEVQVHSGSLLGKKYNWSCDDLMGGGGLHSVG 191

  Fly   185 IYALQLGQFVFGVSPVKILPSGTQLNKERVDVQIDFMLDYGDGRRLVALVTGLENLENDAVITGT 249
            .|.:.|..|:.....||:    ..|.|..|. |.|.             :.|:..:.:|...|  
 Frog   192 SYIIDLLTFLTSQKAVKV----HGLLKTFVK-QTDH-------------IKGIRQITSDDFCT-- 236

  Fly   250 KGEIKLSNYWCCTQISRSNAPPE 272
             .::.|....|||.....|.|.|
 Frog   237 -FQMVLEGGVCCTVTLNFNVPGE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 63/283 (22%)
GFO_IDH_MocA 7..127 CDD:279716 25/133 (19%)
GFO_IDH_MocA_C 142..228 CDD:304482 23/88 (26%)
gfod1XP_012819881.1 MviM 5..376 CDD:223745 63/283 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.