DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3597 and DHDH

DIOPT Version :9

Sequence 1:NP_001259930.1 Gene:CG3597 / 33420 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_055290.1 Gene:DHDH / 27294 HGNCID:17887 Length:334 Species:Homo sapiens


Alignment Length:334 Identity:129/334 - (38%)
Similarity:190/334 - (56%) Gaps:12/334 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNWGIAAAGRITQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDALALDREV 71
            |.|||.:.|.|:.||...|.|:.:|.|.|||||..|..||::|||::.||:.|..::.||.|..|
Human     3 LRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSV 67

  Fly    72 EVVYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNSMWSRFFP 136
            ||.|:||.:|.|.|.|.|.||.||.||||.|..::..:.:|:...|..|.:||||  ::|:||||
Human    68 EVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLME--AIWTRFFP 130

  Fly   137 SYDRLRELLKNDVIGEVTQVKVQHGFRLAHMERVCNRSLGGSILMDIGIYALQLGQFVF-GVSPV 200
            :.:.||.:|....:|::...:.:.|..|.|:.|..:|:..|..|:|||||.:|....|| |..|.
Human   131 ASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPE 195

  Fly   201 KILPSGTQLNKERVDVQIDFMLDY-GD--GRRLVALVTGLENLENDAVITGTKGEIKLSN-YWCC 261
            ||...|.: ::..||..:..:|.| |:  |....::..   .|.|.|.::||||.::|.| .||.
Human   196 KISVVGRR-HETGVDDTVTVLLQYPGEVHGSFTCSITV---QLSNTASVSGTKGMVQLLNPCWCP 256

  Fly   262 TQISRSNAPPESWPLPRAKFDFHYTNTCGLRYEAEEVRRCIEKRLLESPKFTHAESLELAAIADE 326
            |::.......| :|||....|.::.|..|:.|||:.|..|:.|.:.|||....:||..||.|.:|
Human   257 TELVVKGEHKE-FPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEE 320

  Fly   327 IRRQIGVVY 335
            :|:.|||.:
Human   321 VRKAIGVTF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 126/329 (38%)
GFO_IDH_MocA 7..127 CDD:279716 55/119 (46%)
GFO_IDH_MocA_C 142..228 CDD:304482 28/89 (31%)
DHDHNP_055290.1 MviM 1..326 CDD:223745 126/329 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160343
Domainoid 1 1.000 115 1.000 Domainoid score I6039
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57478
OrthoDB 1 1.010 - - D351032at33208
OrthoFinder 1 1.000 - - FOG0001373
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22604
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X868
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.