DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3597 and Blvra

DIOPT Version :9

Sequence 1:NP_001259930.1 Gene:CG3597 / 33420 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006498632.1 Gene:Blvra / 109778 MGIID:88170 Length:337 Species:Mus musculus


Alignment Length:278 Identity:64/278 - (23%)
Similarity:98/278 - (35%) Gaps:91/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GIAAAGRI---------TQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDAL 65
            |:..||.:         :..|:..:|.|.:..     :..:|..|        ||...    |||
Mouse    57 GVGRAGSVRIRDLKDPHSSAFLNLIGYVSRRE-----LGSLDNVR--------QISLE----DAL 104

  Fly    66 ALDREVEVVYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGN-- 128
            . .:||:|.|:.|.:..|...:...|..||:||.|.||.||...|:||:.||.|:|..|.|.:  
Mouse   105 R-SQEVDVAYICTESSSHEDYIRQFLQAGKHVLVEYPMALSFAAAQELWELAAQKGRVLHEEHIE 168

  Fly   129 SMWSRFFPSYDRLRELLKNDVIGEVTQVKVQHGFRLAHMERVCNRSLGGSILMDIGIYALQLGQF 193
            .:...|        |.||.:|.|:                                  .|..|..
Mouse   169 LLMEEF--------EFLKREVAGK----------------------------------ELLKGSL 191

  Fly   194 VFGVSPVKILPSGTQLNKERVDVQIDFMLDYGDGRRLVALVTGLENLEND-AVITGTKGEIKLSN 257
            .|..||::             :.:..|....|     ::.:|.|.:|..: ::|:.|....|...
Mouse   192 RFTASPLE-------------EEKFGFPAFSG-----ISRLTWLVSLFGELSLISATMENRKEDQ 238

  Fly   258 YWCCT-QISRSNAPPESW 274
            |...| |:...|..|.||
Mouse   239 YMKMTVQLETQNKSPLSW 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 64/278 (23%)
GFO_IDH_MocA 7..127 CDD:279716 37/125 (30%)
GFO_IDH_MocA_C 142..228 CDD:304482 12/85 (14%)
BlvraXP_006498632.1 GFO_IDH_MocA 60..163 CDD:366622 35/120 (29%)
Biliv-reduc_cat 174..284 CDD:370334 26/143 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8218
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.