DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axud1 and csrnp1a

DIOPT Version :9

Sequence 1:NP_001259928.1 Gene:Axud1 / 33419 FlyBaseID:FBgn0261647 Length:852 Species:Drosophila melanogaster
Sequence 2:XP_688758.3 Gene:csrnp1a / 560270 ZFINID:ZDB-GENE-070912-475 Length:514 Species:Danio rerio


Alignment Length:305 Identity:130/305 - (42%)
Similarity:180/305 - (59%) Gaps:43/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 EDS-ESDAIDLVP------DMSAPPVAPQKRT-----KRSINFDEVKVFYFPRQQGFSCVPTAGG 328
            ||| :||::|..|      :...|..:..|:|     |.|:.|..|.||.|.|.||:|.||:.||
Zfish    54 EDSPQSDSMDPGPIGSFSSNHHMPISSILKKTKGSQSKGSVRFGSVTVFLFQRCQGYSSVPSHGG 118

  Fly   329 CTLGMGARHVGFKTMTLAEHAAELRRAH----RSQNQE-----LQPRGSSSDDSEESEEDYLS-- 382
            |||||...|...:..||.|||.|.:|..    |.::||     |:.:..||.....:|...|:  
Zfish   119 CTLGMVRWHTARQQFTLPEHAEEQQRLRLVRVRERHQEEKLEALRQKLISSGTLTVTEAARLTVN 183

  Fly   383 -----EGSGSDAEDGSNGFLQPVTPKQRRALLKAAGVRKIDASEKSECRDIRNSREVCGCSCREF 442
                 :|..|.|:....|.|:|.:.|:|||:|:||||.:||..||.:.:|:|.|||.|||.|:.|
Zfish   184 DVPDEDGDLSSAQLKDMGSLRPYSSKRRRAMLRAAGVLRIDREEKRQLQDLRRSREDCGCHCKGF 248

  Fly   443 CDPETCACSQAGIKCQVDRAMFPCGCTREACGNTVGRVEFNPTRVRTHYIHTVMRLDLEQRQGSV 507
            |:||||:|||||||||:||:.|||||::|.|||..||:|||.:|||:|||||.|:|:||:|    
Zfish   249 CEPETCSCSQAGIKCQMDRSNFPCGCSKECCGNPAGRIEFNSSRVRSHYIHTHMKLELEKR---- 309

  Fly   508 QGVQGGHLQPQQQQPSQQTIGY-SPVGTAGSTSAYFLQTQSNYSS 551
                   |...|||.:::.... :||   .|:|..|.|.::::||
Zfish   310 -------LDDTQQQSTERNKSIPNPV---ESSSPPFRQAENSWSS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Axud1NP_001259928.1 CSRNP_N 301..500 CDD:292638 105/214 (49%)
PHA03255 643..>786 CDD:165513
csrnp1aXP_688758.3 CSRNP_N 91..306 CDD:292638 105/214 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596567
Domainoid 1 1.000 217 1.000 Domainoid score I2611
eggNOG 1 0.900 - - E1_KOG3813
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001585
OrthoInspector 1 1.000 - - otm25190
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13580
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1316
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.