DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axud1 and tmem91

DIOPT Version :9

Sequence 1:NP_001259928.1 Gene:Axud1 / 33419 FlyBaseID:FBgn0261647 Length:852 Species:Drosophila melanogaster
Sequence 2:XP_012825141.1 Gene:tmem91 / 100486436 XenbaseID:XB-GENE-22069328 Length:232 Species:Xenopus tropicalis


Alignment Length:55 Identity:12/55 - (21%)
Similarity:29/55 - (52%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LEEQFLELENYPNN--EIIVLGDADLNSSIASDAVSEDPLAIDNILDSASVTTNE 182
            :|..|::....|.:  :::...:.|:: :::.:...||.:.|:|...|.|.|.:|
 Frog    91 IETTFVDNNGSPESCKKLLYSPEKDIH-TVSCEVGEEDIMDIENATSSDSDTDSE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Axud1NP_001259928.1 CSRNP_N 301..500 CDD:292638
PHA03255 643..>786 CDD:165513
tmem91XP_012825141.1 CD225 152..216 CDD:398284
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 215 1.000 Domainoid score I2660
eggNOG 1 0.900 - - E1_KOG3813
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001585
OrthoInspector 1 1.000 - - otm47793
Panther 1 1.100 - - LDO PTHR13580
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3357
SonicParanoid 1 1.000 - - X1316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.900

Return to query results.
Submit another query.