DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and YPT53

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_014306.3 Gene:YPT53 / 855631 SGDID:S000005037 Length:220 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:99/205 - (48%)
Similarity:128/205 - (62%) Gaps:18/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
            |:||||||||||||:|||||...|.|.:|.||||||||:.|..:..|:||||||||||||:..||
Yeast    14 KVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLA 78

  Fly    96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSN------IRVVEF 154
            |||||.||||:||:|:.|:.||.:|:.||:|||::...:|||||.|||.||.|      .|.::.
Yeast    79 PMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENENRAMKA 143

  Fly   155 DEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDG------------ANNQGTSIRPTG 207
            ...:...|...||:.|.|||||.|:..||..:.:|:|..:.            .:||...:..|.
Yeast   144 PAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPCPEQNTRQSSTHDRTITDNQRIDLESTT 208

  Fly   208 TETNRPTNNC 217
            .|:.|.|..|
Yeast   209 VESTRETGGC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 91/165 (55%)
YPT53NP_014306.3 Rab5_related 12..180 CDD:206653 91/165 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 203 1.000 Domainoid score I541
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I829
Isobase 1 0.950 - 0 Normalized mean entropy S266
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46865
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X457
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.