DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and YPT52

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_012939.1 Gene:YPT52 / 853884 SGDID:S000001722 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:119/232 - (51%)
Similarity:141/232 - (60%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICI--------EDTVVKFEIWDT 85
            ||||||||:|:|||||:|.||||..|.|.:|||||||||:|:|.|        :|.|:|||||||
Yeast     3 QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDT 67

  Fly    86 AGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKEL-HKQASPNIVIALAGNKADL--- 146
            ||||||.||||||||.|.||:|||||..:||.|:|:.||.|| :|....::||.|.|||.||   
Yeast    68 AGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQE 132

  Fly   147 ---------SN--------IRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL--PK 192
                     ||        :|.:..:||||||:|.||||.|.|||||..|.:||..|.:||  .|
Yeast   133 TPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKLYDLK 197

  Fly   193 ND-----------GANNQGTSIRPTGTETNRPTNNCC 218
            .|           |.||....|......||.|| :||
Yeast   198 KDEILSKQNRQIGGGNNGQVDINLQRPSTNDPT-SCC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 107/192 (56%)
YPT52NP_012939.1 Rab5_related 3..194 CDD:206653 106/190 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.