DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RSR1

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_011668.3 Gene:RSR1 / 853056 SGDID:S000003384 Length:272 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:60/210 - (28%)
Similarity:110/210 - (52%) Gaps:28/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSL 94
            :|||:||...||||.|.::||:|.:.:..:.||..:: .:||.|::.|...||.||||..::.::
Yeast     4 YKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTIEIDNKVFDLEILDTAGIAQFTAM 67

  Fly    95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQA-----SPNIVIALAGNKADLSNIRVVEF 154
            ..:|.:.....::||.:.::.|.:.    :.||.:|.     |..:.:.|.||||||.|.||:..
Yeast    68 RELYIKSGMGFLLVYSVTDRQSLEE----LMELREQVLRIKDSDRVPMVLIGNKADLINERVISV 128

  Fly   155 DEAKQYAEENGLL-FMETSAKTGMNVNDIFLAIAKKLPKND-------GANNQ----------GT 201
            :|..:.:.:.|.: |.||||....||:::|:.:.:::.:|:       .|.||          .|
Yeast   129 EEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVKDARNQSQQFSKIESPST 193

  Fly   202 SIRPTGTETNRPTNN 216
            .:..:..:..:.:||
Yeast   194 RLPSSAKQDTKQSNN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 53/166 (32%)
RSR1NP_011668.3 RSR1 3..166 CDD:133377 53/166 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.