DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and YPT10

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_009823.2 Gene:YPT10 / 852567 SGDID:S000000468 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:81/186 - (43%)
Similarity:109/186 - (58%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICI------EDTVVKFEIWDTAGQE 89
            |:||||:|:|||:|:|.|...|:|.....:||||||:|:||.:      .:..:..|||||||||
Yeast     6 KVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIWDTAGQE 70

  Fly    90 RYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVE- 153
            ||.||.|||||.|..|::|:::.:..|.|.||||.::|..:|....|| :.|||.||    |.| 
Yeast    71 RYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVI-IVGNKYDL----VCEE 130

  Fly   154 -FDEAKQYAEENGLLFMETSAKTGMN---VNDIFLAIA-----KKLPKNDGANNQG 200
             ..|....||..||.::..|||||.|   :|.|.:::.     |.|.||   |.||
Yeast   131 HSGEVTIPAELQGLPYVAVSAKTGYNFDTLNKIIISLVPESQFKTLSKN---NEQG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 75/175 (43%)
YPT10NP_009823.2 Rab 5..158 CDD:206640 72/156 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.