DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and YPT6

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_013363.1 Gene:YPT6 / 850966 SGDID:S000004252 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:76/199 - (38%)
Similarity:125/199 - (62%) Gaps:10/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWD 84
            :|.|..|   :|:|.|||..|||:||:.||:...|.::.::|||..||::|:.::|..::.::||
Yeast     4 SGKSLTK---YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWD 65

  Fly    85 TAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKEL-HKQASPNIVIALAGNKADLSN 148
            ||||||:.||.|.|.|.::.||:||||..:.||:....|:::: :::...|:::.:.|||:|||:
Yeast    66 TAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSD 130

  Fly   149 IRVVEFDEAKQYAEENGL-LFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGT---SIRPTGTE 209
            .|.:..:|.::.|:..|. :|||||.|.|.||..:|..|||.||  :..|::.|   |.......
Yeast   131 ERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLP--EFQNSESTPLDSENANSAN 193

  Fly   210 TNRP 213
            .|:|
Yeast   194 QNKP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 66/163 (40%)
YPT6NP_013363.1 Rab6 11..173 CDD:206654 66/161 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.