DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAB6C

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_115520.2 Gene:RAB6C / 84084 HGNCID:16525 Length:254 Species:Homo sapiens


Alignment Length:188 Identity:73/188 - (38%)
Similarity:110/188 - (58%) Gaps:4/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDT 85
            |...|...:||||.|||.:|.|:||:.||....|....::.||..||::|:.:||..:...:|||
Human     5 GDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDT 69

  Fly    86 AGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIR 150
            |||||..||.|.|.|.:.||:|||||.|.:|||:...|:.::..:...:::|.|.||:.||::.|
Human    70 AGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIITLVGNRTDLADKR 134

  Fly   151 VVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLP----KNDGANNQGTSIR 204
            .|..:|.::.|:...:.|:||.||.|.||..:|..:|..||    ..||:....:.|:
Human   135 QVSVEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 66/161 (41%)
RAB6CNP_115520.2 Required for centrosome localization 1..174 68/168 (40%)
Rab6 14..174 CDD:206654 66/159 (42%)
RAB 14..171 CDD:197555 65/156 (42%)
Effector region. /evidence=ECO:0000250 42..50 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.