DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RABH1a

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001190616.1 Gene:RABH1a / 836623 AraportID:AT5G64990 Length:213 Species:Arabidopsis thaliana


Alignment Length:175 Identity:69/175 - (39%)
Similarity:102/175 - (58%) Gaps:7/175 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIW-------DTAG 87
            :|||.||:..|||:|::..|:.|:|....::|||..||::|...||...:.::|       ||||
plant     8 YKLVFLGDQGVGKTSIITCFMYGKFDTSYQATIGIDFLSKTTRYEDRTFRLQLWYKKLSLGDTAG 72

  Fly    88 QERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVV 152
            |||:.||.|.|.|.:..|::|||:.::.||.....|::|:..:....::|.|.|||.||.|.|.|
plant    73 QERFKSLVPSYIRDSSVAVIVYDVASKQSFINTSKWIEEVRAERGSYVIIVLVGNKTDLVNKRQV 137

  Fly   153 EFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN 197
            ..:|.:..|.|.|.||||||||.|.|:..:|..|...|..|:..:
plant   138 SIEEGENKAREFGALFMETSAKAGFNIKPLFCKITSALQGNEAVS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 67/167 (40%)
RABH1aNP_001190616.1 Rab6 8..175 CDD:206654 67/166 (40%)
Ras 9..168 CDD:278499 65/158 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.