DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAN2

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_197502.1 Gene:RAN2 / 832124 AraportID:AT5G20020 Length:221 Species:Arabidopsis thaliana


Alignment Length:168 Identity:60/168 - (35%)
Similarity:93/168 - (55%) Gaps:17/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAA-----FLTQTICIEDTVVKFEIWDTAGQE 89
            ||||::|:...||::.|.|.:.|:|.:..|.|||..     |.|.  |.:   ::|..|||||||
plant    14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTN--CGK---IRFYCWDTAGQE 73

  Fly    90 RYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEF 154
            ::..|...||...|.||:::|:..:.:::...||.::|.: ...||.|.|.|||.|:.|.:|   
plant    74 KFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDVKNRQV--- 134

  Fly   155 DEAKQ--YAEENGLLFMETSAKTGMNVNDIFLAIAKKL 190
             :|||  :..:..|.:.|.|||:..|....||.:|:||
plant   135 -KAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 60/168 (36%)
RAN2NP_197502.1 PLN03071 1..219 CDD:178620 60/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.