DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RABA4B

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_195709.1 Gene:RABA4B / 830160 AraportID:AT4G39990 Length:224 Species:Arabidopsis thaliana


Alignment Length:225 Identity:90/225 - (40%)
Similarity:127/225 - (56%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICI 73
            |..|.|      |.|......||:||:|:||||||.|:.||.:.:|....::|||..|.|:|:.|
plant     3 GGGGYG------GASGKVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSI 61

  Fly    74 EDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIA 138
            |...:|.:||||||||||.::...|||||..|::|||:..:::|:....|::||...|..||||.
plant    62 EQKSIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVII 126

  Fly   139 LAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAI---------AKKLPKND 194
            |.|||:||.:.|.|..::||::||:.||.|:||||....||.:.|..:         .|.|....
plant   127 LIGNKSDLEDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTQIYNTVNKKNLASEG 191

  Fly   195 GANNQGT------SIRPTGTETNRPTNNCC 218
            .:||.|:      .|..:|.|....|:.||
plant   192 DSNNPGSLAGKKILIPGSGQEIPAKTSTCC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 75/170 (44%)
RABA4BNP_195709.1 PLN03110 15..223 CDD:178657 85/207 (41%)
Rab11_like 15..179 CDD:206660 74/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.