DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RABH1c

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_195699.1 Gene:RABH1c / 830148 AraportID:AT4G39890 Length:214 Species:Arabidopsis thaliana


Alignment Length:167 Identity:71/167 - (42%)
Similarity:107/167 - (64%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            :||||.||:.:|||:|::.||:..:|....:.|||..||::|:.:||..|:.::||||||||:.|
plant     9 KFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRS 73

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQ-ASPNIVIALAGNKADLSNIRVVEFDEA 157
            |.|.|.|.:..||||||:.|:.:|.....|::::|:: ...|::|.|.|||.||...|.|...|.
plant    74 LIPSYIRDSSVAIVVYDVSNRQTFLNTSKWIEDVHRERGQSNVIIVLVGNKTDLVEKRQVSISEG 138

  Fly   158 KQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND 194
            :...:|.|::|:|||||...|:..:|..||..||..|
plant   139 EDKGKEYGVMFIETSAKENFNIKALFRKIAAALPGVD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 68/162 (42%)
RABH1cNP_195699.1 Rab6 10..171 CDD:206654 68/160 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.