DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RABA1g

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_188124.1 Gene:RABA1g / 820735 AraportID:AT3G15060 Length:217 Species:Arabidopsis thaliana


Alignment Length:211 Identity:82/211 - (38%)
Similarity:121/211 - (57%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSL 94
            :|:||:|:|.||||:|:.||.:.:|....:||||..|.|::|.:::.:||.:||||||||||.::
plant    14 YKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDEKIVKAQIWDTAGQERYRAI 78

  Fly    95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159
            ...|||||..|::|||:....:|:..:.|:|||......||||.|.||||||.::|.|..::||.
plant    79 TSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTEANIVIMLVGNKADLRHLRAVSTEDAKA 143

  Fly   160 YAEENGLLFMETSAKTGMNVNDIFLAI--------AKK----------LPK----NDGANNQGTS 202
            :||.....||||||...:||.:.|..:        :||          |||    |.|:.:..:.
plant   144 FAERENTFFMETSALEALNVENAFTEVLSQIYRVASKKALDIGDDHTTLPKGQSINVGSKDDVSE 208

  Fly   203 IRPTGTETNRPTNNCC 218
            ::..|         ||
plant   209 VKKVG---------CC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 74/178 (42%)
RABA1gNP_188124.1 Rab11_like 11..175 CDD:206660 72/160 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.