DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and ARA4

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_181842.1 Gene:ARA4 / 818915 AraportID:AT2G43130 Length:214 Species:Arabidopsis thaliana


Alignment Length:214 Identity:81/214 - (37%)
Similarity:116/214 - (54%) Gaps:39/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSL 94
            ||:|::|:||||||:|:.|:.:.:|:...::|||..|.||::.|:...||.:|||||||||:.::
plant    13 FKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAGQERFRAV 77

  Fly    95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159
            ...|||||..|:|||||....:|:....|:.||:..:...:...|.|||.||.:||.|..:|.|.
plant    78 TSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLESIRAVSVEEGKS 142

  Fly   160 YAEENGLLFMETSAKTGMNV--------NDIFLAIAKK-----------------LPKNDGANNQ 199
            .||..||.||||||....||        .:|:..|::|                 |.||:   |:
plant   143 LAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEELTVNRVSLVKNE---NE 204

  Fly   200 GTSIRPTGTETNRPTNNCC 218
            ||.           |.:||
plant   205 GTK-----------TFSCC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 72/185 (39%)
ARA4NP_181842.1 Rab11_like 10..174 CDD:206660 69/160 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.