DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab3b

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_076026.1 Gene:Rab3b / 69908 MGIID:1917158 Length:219 Species:Mus musculus


Alignment Length:164 Identity:62/164 - (37%)
Similarity:94/164 - (57%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWD 84
            :.:.||....|||:::|.|:|||:|.:.|:....|.....||:|..|..:|:...:..||.:|||
Mouse    13 DASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWD 77

  Fly    85 TAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNI 149
            |||||||.::...|||||...|::|||.|::||...:.|..::...:..|..:.|.|||.|:...
Mouse    78 TAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEE 142

  Fly   150 RVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIF 183
            |||..::.:..||:.|..|.|.|||..::|...|
Mouse   143 RVVPTEKGRLLAEQLGFDFFEASAKENISVRQAF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 60/155 (39%)
Rab3bNP_076026.1 Rab3 22..186 CDD:206657 60/155 (39%)
Effector region. /evidence=ECO:0000250 51..59 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.