DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab20

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001103005.1 Gene:Rab20 / 689377 RGDID:1593487 Length:232 Species:Rattus norvegicus


Alignment Length:205 Identity:62/205 - (30%)
Similarity:94/205 - (45%) Gaps:52/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFE 81
            ::|:|         |:||||:..|||:||:.|:::.:|.: ..||:|.||..:    :.......
  Rat     2 RKPDG---------KIVLLGDMNVGKTSLLQRYMERRFPD-TVSTVGGAFYLK----QWRSFNIS 52

  Fly    82 IWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146
            ||||||:|::|.|..||.|||.|.|:.||:.|..|....:.....|.:.|:.:.:.|:.|||.||
  Rat    53 IWDTAGREQFHGLGSMYCRGAAAIILTYDVNNPQSLFELEDRFLGLTETANNDCLFAIVGNKVDL 117

  Fly   147 SNIRVVEFDEAKQYAEENG--------------------------------------LLFMETSA 173
            :..|..|..|..|.:.:.|                                      .:..||||
  Rat   118 TTERGPEGGEKDQASGKTGSCVSSKVPKQVHPEDAMALYKKILKYKMLDEREMPGAEQMCFETSA 182

  Fly   174 KTGMNVNDIF 183
            |||.||:.:|
  Rat   183 KTGHNVDLLF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 60/193 (31%)
Rab20NP_001103005.1 Rab20 7..231 CDD:133326 60/191 (31%)
Ras 7..195 CDD:278499 60/191 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.