Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001103005.1 | Gene: | Rab20 / 689377 | RGDID: | 1593487 | Length: | 232 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 62/205 - (30%) |
---|---|---|---|
Similarity: | 94/205 - (45%) | Gaps: | 52/205 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 QRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFE 81
Fly 82 IWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146
Fly 147 SNIRVVEFDEAKQYAEENG--------------------------------------LLFMETSA 173
Fly 174 KTGMNVNDIF 183 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 60/193 (31%) |
Rab20 | NP_001103005.1 | Rab20 | 7..231 | CDD:133326 | 60/191 (31%) |
Ras | 7..195 | CDD:278499 | 60/191 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0092 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |