DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rabl2

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_030104587.1 Gene:Rabl2 / 68708 MGIID:1915958 Length:227 Species:Mus musculus


Alignment Length:69 Identity:19/69 - (27%)
Similarity:28/69 - (40%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PNIVIALAGN-KADLSNIRVVEFDEAK-QYAEENGLLFMETSAKTGMNVNDIF-----LAIAKKL 190
            ||....|.|. .|.|.:...::..:.. .:|::..|.....||..|.||..:|     ||:|.|.
Mouse   123 PNSSHCLGGQANAPLLSAADIQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKE 187

  Fly   191 PKND 194
            ...|
Mouse   188 SSQD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 18/64 (28%)
Rabl2XP_030104587.1 P-loop_NTPase <141..186 CDD:393306 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.