powered by:
Protein Alignment Rab5 and Rabl2
DIOPT Version :9
Sequence 1: | NP_001259925.1 |
Gene: | Rab5 / 33418 |
FlyBaseID: | FBgn0014010 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_030104587.1 |
Gene: | Rabl2 / 68708 |
MGIID: | 1915958 |
Length: | 227 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 28/69 - (40%) |
Gaps: | 7/69 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 PNIVIALAGN-KADLSNIRVVEFDEAK-QYAEENGLLFMETSAKTGMNVNDIF-----LAIAKKL 190
||....|.|. .|.|.:...::..:.. .:|::..|.....||..|.||..:| ||:|.|.
Mouse 123 PNSSHCLGGQANAPLLSAADIQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKE 187
Fly 191 PKND 194
...|
Mouse 188 SSQD 191
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1340129at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.