DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAB17

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_016860182.1 Gene:RAB17 / 64284 HGNCID:16523 Length:338 Species:Homo sapiens


Alignment Length:126 Identity:65/126 - (51%)
Similarity:88/126 - (69%) Gaps:2/126 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSL 94
            |||||||..:||||||.||:||..|.... .|:|.||.|:.:.:..|.:|.|||||||||:|||:
Human    20 FKLVLLGSGSVGKSSLALRYVKNDFKSIL-PTVGCAFFTKVVDVGATSLKLEIWDTAGQEKYHSV 83

  Fly    95 APMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASP-NIVIALAGNKADLSNIRVVEF 154
            ..:|:|||.||::||||..:|||.:|:.|:|:|.::..| .:::.|.|||.|||..|.|.|
Human    84 CHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQEREVTF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 65/126 (52%)
RAB17XP_016860182.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.