DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab5d

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001025576.1 Gene:rab5d / 594964 XenbaseID:XB-GENE-489496 Length:213 Species:Xenopus tropicalis


Alignment Length:207 Identity:143/207 - (69%)
Similarity:172/207 - (83%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEI 82
            |.||..|.|.|||||||||:.||||||||||||||||.|:||:|||||||.|::|::||.|||||
 Frog     8 RANGVGQTKICQFKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDDTTVKFEI 72

  Fly    83 WDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLS 147
            ||||||||||||||||||||||||||:||...::|.|||.|||||.:||||||||||||||:||:
 Frog    73 WDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFDRAKAWVKELQRQASPNIVIALAGNKSDLA 137

  Fly   148 NIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN------NQGTSIRPT 206
            ..|:||::||:.|||:.|||||||||||.||||::|||||||:||:|..|      |:|.:::  
 Frog   138 EKRMVEYEEAQAYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKSDAQNPTHAARNRGVNVQ-- 200

  Fly   207 GTETNRPTNNCC 218
            |:| .:|.:.||
 Frog   201 GSE-QQPRSGCC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 126/161 (78%)
rab5dNP_001025576.1 Rab5_related 19..181 CDD:206653 126/161 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 275 1.000 Domainoid score I1722
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm48913
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.