DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RALB

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001356329.1 Gene:RALB / 5899 HGNCID:9840 Length:206 Species:Homo sapiens


Alignment Length:212 Identity:63/212 - (29%)
Similarity:110/212 - (51%) Gaps:19/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKF 80
            |.:..|  |:.....|::::|...||||:|.|:|:..:|.|..|.|...:: .:.:.::...|:.
Human     3 ANKSKG--QSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY-RKKVVLDGEEVQI 64

  Fly    81 EIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKEL--HKQASPNIVIALAGNK 143
            :|.||||||.|.::...|:|..:..::|:.|...:||.....:.:::  .|.....|.:.:.|||
Human    65 DILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNK 129

  Fly   144 ADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAI-----AKKLPKNDGANNQGTSI 203
            :||...|.|..:||:..|||.|:.::||||||..||:.:|..:     .||:.:|...|.:.:| 
Human   130 SDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSS- 193

  Fly   204 RPTGTETNRPT--NNCC 218
                  .|:.:  ..||
Human   194 ------KNKKSFKERCC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 54/168 (32%)
RALBNP_001356329.1 RalA_RalB 15..178 CDD:206710 52/163 (32%)
Effector region 43..51 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..206 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.