Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005393.2 | Gene: | RALA / 5898 | HGNCID: | 9839 | Length: | 206 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 63/207 - (30%) |
---|---|---|---|
Similarity: | 106/207 - (51%) | Gaps: | 9/207 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 AQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKF 80
Fly 81 EIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKE-LHKQASPNIVIALAGNKA 144
Fly 145 DLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL---PKNDGANNQGTSIRPT 206
Fly 207 GTETNRPTNNCC 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 52/165 (32%) |
RALA | NP_005393.2 | RalA_RalB | 15..177 | CDD:206710 | 52/162 (32%) |
Effector region | 43..51 | 2/7 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |