DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RALA

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_005393.2 Gene:RALA / 5898 HGNCID:9839 Length:206 Species:Homo sapiens


Alignment Length:207 Identity:63/207 - (30%)
Similarity:106/207 - (51%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKF 80
            |.:|.|  ||.....|::::|...||||:|.|:|:..:|.|..|.|...:: .:.:.::...|:.
Human     3 ANKPKG--QNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY-RKKVVLDGEEVQI 64

  Fly    81 EIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKE-LHKQASPNIVIALAGNKA 144
            :|.||||||.|.::...|:|..:..:.|:.|...:||.....:.:: |..:...|:...|.|||:
Human    65 DILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKS 129

  Fly   145 DLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL---PKNDGANNQGTSIRPT 206
            ||.:.|.|..:|||..||:..:.::||||||..||:.:|..:.:::   ...|.....|...|. 
Human   130 DLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRK- 193

  Fly   207 GTETNRPTNNCC 218
             :...|....||
Human   194 -SLAKRIRERCC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 52/165 (32%)
RALANP_005393.2 RalA_RalB 15..177 CDD:206710 52/162 (32%)
Effector region 43..51 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.