DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAB5C

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001238968.1 Gene:RAB5C / 5878 HGNCID:9785 Length:249 Species:Homo sapiens


Alignment Length:221 Identity:161/221 - (72%)
Similarity:178/221 - (80%) Gaps:5/221 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTPRSGGASGTGTAQRPNG-TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAF 66
            ||......:|.|.|.|||| .:.||.|||||||||||||||||||||||||||||||||||||||
Human    27 TTTAGRAMAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAF 91

  Fly    67 LTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQA 131
            ||||:|::||.||||||||||||||||||||||||||||||||||.|.|:|.|||.|||||.:||
Human    92 LTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQA 156

  Fly   132 SPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGA 196
            |||||||||||||||::.|.|||.||:.||::|.||||||||||.||||:||:|||||||||:..
Human   157 SPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQ 221

  Fly   197 NNQGTSIRPTGT--ETNRPT--NNCC 218
            |..|...|..|.  :.|.|.  :.||
Human   222 NATGAPGRNRGVDLQENNPASRSQCC 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 137/161 (85%)
RAB5CNP_001238968.1 Rab5_related 54..216 CDD:206653 137/161 (85%)
Ras 56..217 CDD:278499 136/160 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159252
Domainoid 1 1.000 277 1.000 Domainoid score I1733
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55533
Inparanoid 1 1.050 311 1.000 Inparanoid score I2594
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm41694
orthoMCL 1 0.900 - - OOG6_100743
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.690

Return to query results.
Submit another query.