DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAB5A

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_004153.2 Gene:RAB5A / 5868 HGNCID:9783 Length:215 Species:Homo sapiens


Alignment Length:208 Identity:156/208 - (75%)
Similarity:174/208 - (83%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQRPNG-TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVK 79
            |.|||| .:.||.|||||||||||||||||||||||||||||:|||||||||||||:|::||.||
Human     6 ATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK 70

  Fly    80 FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKA 144
            ||||||||||||||||||||||||||||||||.|::||.|||.|||||.:||||||||||:||||
Human    71 FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKA 135

  Fly   145 DLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTE 209
            ||:|.|.|:|.||:.||::|.||||||||||.||||:||:|||||||||:..|....|.|..|.:
Human   136 DLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVD 200

  Fly   210 TNRPT----NNCC 218
            ...||    |.||
Human   201 LTEPTQPTRNQCC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 135/161 (84%)
RAB5ANP_004153.2 Rab5_related 20..182 CDD:206653 135/161 (84%)
Effector region. /evidence=ECO:0000255 49..57 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..215 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1733
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 311 1.000 Inparanoid score I2594
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm41694
orthoMCL 1 0.900 - - OOG6_100743
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.