DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab6ba

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_005165989.1 Gene:rab6ba / 558900 ZFINID:ZDB-GENE-050809-136 Length:258 Species:Danio rerio


Alignment Length:163 Identity:74/163 - (45%)
Similarity:111/163 - (68%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            :||||.|||.:|||:||:.||:...|....::|||..||::|:.:||..|:.::||||||||:.|
Zfish    63 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRS 127

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAK 158
            |.|.|.|.:..|:|||||.|.:|||:...|:.::..:...:::|.|.|||.||::.|.:..:|.:
Zfish   128 LIPSYIRDSTVAVVVYDITNVNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGE 192

  Fly   159 QYAEENGLLFMETSAKTGMNVNDIFLAIAKKLP 191
            |.|:|..::|:|||||||.||..:|..:|..||
Zfish   193 QRAKELSVMFIETSAKTGYNVKQLFRRVAAALP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 72/161 (45%)
rab6baXP_005165989.1 Rab6 64..224 CDD:206654 72/159 (45%)
RAB 64..221 CDD:197555 71/156 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.