DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAB20

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_060287.1 Gene:RAB20 / 55647 HGNCID:18260 Length:234 Species:Homo sapiens


Alignment Length:242 Identity:68/242 - (28%)
Similarity:101/242 - (41%) Gaps:69/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
            |:||||:..|||:||:.|:::.:|.: ..||:|.||..:    :.......||||||:|::|.|.
Human     7 KIVLLGDMNVGKTSLLQRYMERRFPD-TVSTVGGAFYLK----QWRSYNISIWDTAGREQFHGLG 66

  Fly    96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSN------------ 148
            .||.|||.|.|:.||:.::.|....:.....|...||.:.:.|:.|||.||:.            
Human    67 SMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEEC 131

  Fly   149 ------------------------------IRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIF 183
                                          ::....||....|.|.  :..|||||||.||:.:|
Human   132 SPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQ--MCFETSAKTGYNVDLLF 194

  Fly   184 -----LAIAKKLPKNDGANNQGTSIRPTGT-------ETNRPTNNCC 218
                 |.:...|        |..:.||:.|       ...|..:.||
Human   195 ETLFDLVVPMIL--------QQRAERPSHTVDISSHKPPKRTRSGCC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 60/206 (29%)
RAB20NP_060287.1 Rab20 6..233 CDD:133326 66/240 (28%)
Effector region. /evidence=ECO:0000250 33..41 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..144 0/18 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..234 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.