Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060287.1 | Gene: | RAB20 / 55647 | HGNCID: | 18260 | Length: | 234 | Species: | Homo sapiens |
Alignment Length: | 242 | Identity: | 68/242 - (28%) |
---|---|---|---|
Similarity: | 101/242 - (41%) | Gaps: | 69/242 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
Fly 96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSN------------ 148
Fly 149 ------------------------------IRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIF 183
Fly 184 -----LAIAKKLPKNDGANNQGTSIRPTGT-------ETNRPTNNCC 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 60/206 (29%) |
RAB20 | NP_060287.1 | Rab20 | 6..233 | CDD:133326 | 66/240 (28%) |
Effector region. /evidence=ECO:0000250 | 33..41 | 3/7 (43%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 125..144 | 0/18 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..234 | 6/22 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0092 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |