DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab20

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_012812505.1 Gene:rab20 / 550049 XenbaseID:XB-GENE-494912 Length:272 Species:Xenopus tropicalis


Alignment Length:258 Identity:79/258 - (30%)
Similarity:114/258 - (44%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TPRSGGASGTGTAQRP-NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFL 67
            |....|..|:...||. ..||..|....||||||:..|||:||:.|:::.:|.: ..||:|.||.
 Frog    26 TGSKDGRPGSDVMQRLWFQTSSMKKPDLKLVLLGDMNVGKTSLLHRYMERRFQD-TVSTVGGAFY 89

  Fly    68 TQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQAS 132
            .:    :.......||||||:|::|.|..||.|.|.|.|:.||:.|..|....:.....|...|:
 Frog    90 LK----QWGPYNISIWDTAGREQFHGLGSMYCRAASAVILTYDVSNMQSLLELEDRFLGLTDTAN 150

  Fly   133 PNIVIALAGNKADL------------------SNIR-VVEFDEA---------KQYAEENGL--- 166
            .:.:.|:.|||.||                  |.|| .|:.::|         .:..:||.:   
 Frog   151 DDCIFAVVGNKIDLTDDYDSESDMEGERPRTSSKIRKQVDLEDAIALYKRIMKYKMLDENVVPAA 215

  Fly   167 --LFMETSAKTGMNVNDIF---------LAIAKKLPKNDGANNQGTSIRPTGTETNRPTNNCC 218
              :..|||||||.||:.:|         |.:.||...:|...|...|      :..:..|.||
 Frog   216 EKMCFETSAKTGYNVDGLFEGVFNMVVPLIVKKKASGHDETVNLAQS------KPEKSKNRCC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 65/203 (32%)
rab20XP_012812505.1 Rab20 53..272 CDD:133326 69/229 (30%)
Ras 54..235 CDD:278499 61/185 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.