Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026847.1 | Gene: | RAB24 / 53917 | HGNCID: | 9765 | Length: | 203 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 78/203 - (38%) |
---|---|---|---|
Similarity: | 116/203 - (57%) | Gaps: | 25/203 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KLVLLGESAVGKSSLVLRFVKGQF--HEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
Fly 94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL----SNIRVVEF 154
Fly 155 DEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKK---------LPKNDGANNQGTSIRPTGTET 210
Fly 211 NRPTNNCC 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 73/174 (42%) |
RAB24 | NP_001026847.1 | Rab24 | 8..201 | CDD:133318 | 76/201 (38%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 6/8 (75%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0092 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |