DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and RAB23

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001265595.1 Gene:RAB23 / 51715 HGNCID:14263 Length:237 Species:Homo sapiens


Alignment Length:225 Identity:72/225 - (32%)
Similarity:116/225 - (51%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
            |:|::|..||||||::.|:.||.|.:..:.|||..||.:.|.:.|..|:..:|||||||.:.::.
Human    11 KMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAIT 75

  Fly    96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQY 160
            ..|||||||.::|:...:::||:...:|.:::..:.. :|...|..||.||.:...::.:||:..
Human    76 KAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVG-DIPTVLVQNKIDLLDDSCIKNEEAEAL 139

  Fly   161 AEENGLLFMETSAKTGMNVNDIFLAIAKK-LPK-------------------------------- 192
            |:...|.|..||.|..:|||::|..:|:| |.|                                
Human   140 AKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQ 204

  Fly   193 NDGANNQG--TSIRPT--GTETNR-PTNNC 217
            |.|..|.|  .::||.  .|:.|| |.::|
Human   205 NSGTLNGGDVINLRPNKQRTKKNRNPFSSC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 59/160 (37%)
RAB23NP_001265595.1 Rab23_like 10..169 CDD:133306 58/158 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.