Sequence 1: | NP_001259925.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265595.1 | Gene: | RAB23 / 51715 | HGNCID: | 14263 | Length: | 237 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 72/225 - (32%) |
---|---|---|---|
Similarity: | 116/225 - (51%) | Gaps: | 39/225 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
Fly 96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQY 160
Fly 161 AEENGLLFMETSAKTGMNVNDIFLAIAKK-LPK-------------------------------- 192
Fly 193 NDGANNQG--TSIRPT--GTETNR-PTNNC 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab5 | NP_001259925.1 | Rab5_related | 29..191 | CDD:206653 | 59/160 (37%) |
RAB23 | NP_001265595.1 | Rab23_like | 10..169 | CDD:133306 | 58/158 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |