DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab17

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001102833.1 Gene:Rab17 / 503269 RGDID:1562478 Length:213 Species:Rattus norvegicus


Alignment Length:202 Identity:89/202 - (44%)
Similarity:125/202 - (61%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLA 95
            ||||||.|:|||:||.||::|..|.... .|:|.||.|:.:.:..:.:|.|||||||||:|||:.
  Rat    21 KLVLLGSSSVGKTSLALRYMKQDFSNVL-PTVGCAFFTKVVDLGSSSLKLEIWDTAGQEKYHSVC 84

  Fly    96 PMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASP-NIVIALAGNKADLSNIRVVEFDEAKQ 159
            .:|:|||.||::||||..:|||.:|:.|:::|.|:..| .:|:.|.|||.||...|.|.|.|.|:
  Rat    85 HLYFRGANAALLVYDITRKDSFHKAQQWLEDLEKEFHPGEVVVMLVGNKTDLGEEREVTFQEGKE 149

  Fly   160 YAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK--NDGAN-----------NQGTSIRPTGTETN 211
            :||...|||||:|||....|::||..||::|.:  .||.:           |||.::||      
  Rat   150 FAESKSLLFMESSAKLNYQVSEIFNTIAQELLQRAGDGQSSSPQEGEAVVLNQGPTVRP------ 208

  Fly   212 RPTNNCC 218
               ..||
  Rat   209 ---RQCC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 79/160 (49%)
Rab17NP_001102833.1 Rab5_related 21..181 CDD:206653 79/160 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.