DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rab7b

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001102798.1 Gene:Rab7b / 501854 RGDID:1562617 Length:199 Species:Rattus norvegicus


Alignment Length:202 Identity:64/202 - (31%)
Similarity:113/202 - (55%) Gaps:16/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQER 90
            |....||:::|...|||:||:.::|...|.|..::|:||:.|::.|.::||.:|.:||||.||||
  Rat     5 KKVDLKLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQIWDTGGQER 69

  Fly    91 YHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKEL------HKQASPNIVIALAGNKADLSNI 149
            :.|:...:|:|:...|:.:|:.:.:||:....|..::      .:|:.|.:|:   |||.||.: 
  Rat    70 FRSMVSTFYKGSDGCILAFDVTDPESFEALDIWRDDVLAKIVPMEQSYPMVVL---GNKIDLED- 130

  Fly   150 RVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKK-LPKNDG--ANNQGTSIRPTGTETN 211
            |.|..:.|.::.:|..:.:.|.|||..:||...|..:|.: |.:..|  .|:...||:   ....
  Rat   131 RKVPQEVAHEWCKEKDMPYFEVSAKNDINVVQAFEVLASRALLRYQGIAENHLADSIK---LSPG 192

  Fly   212 RPTNNCC 218
            :|.:.||
  Rat   193 QPRSKCC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 55/168 (33%)
Rab7bNP_001102798.1 Rab 9..169 CDD:206640 54/163 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.