DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and Rit1

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_038958818.1 Gene:Rit1 / 499652 RGDID:1559874 Length:219 Species:Rattus norvegicus


Alignment Length:182 Identity:56/182 - (30%)
Similarity:100/182 - (54%) Gaps:6/182 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RPNGTSQNK----SCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVV 78
            ||.|:|.:.    |.::|||:||...||||::.::|:..:|.|..:.||..|:..: |.|:|...
  Rat     6 RPVGSSCSSPAALSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIR-IRIDDEPA 69

  Fly    79 KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHK-QASPNIVIALAGN 142
            ..:|.|||||..:.::...|.|..:..|:.|.|.::.||...:.:.:.::: :.:.:..:.|.||
  Rat    70 NLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGN 134

  Fly   143 KADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND 194
            |:||..:|.|..:|....|.|....|.||||.....::|:|.|:.:::.|.:
  Rat   135 KSDLKQLRQVSKEEGLSLAREFNCPFFETSAAYRYYIDDVFHALVREIRKKE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 50/162 (31%)
Rit1XP_038958818.1 Rit_Rin_Ric 20..191 CDD:206712 51/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.