DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and rab5a

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001008068.1 Gene:rab5a / 493430 XenbaseID:XB-GENE-482011 Length:216 Species:Xenopus tropicalis


Alignment Length:210 Identity:155/210 - (73%)
Similarity:177/210 - (84%) Gaps:5/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTAQRPNG-TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTV 77
            |.|.|||| .:.||.|||||||||||||||||||||||||||||:|||||||||||||:|::||.
 Frog     5 GGATRPNGPNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTT 69

  Fly    78 VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGN 142
            ||||||||||||||||||||||||||||||||||.|::||.|||.|||||.:||||||||||:||
 Frog    70 VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGN 134

  Fly   143 KADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTG 207
            ||||::.|.|:|.||:.||::|.||||||||||.:|||:||:||||||||.:.......:||..|
 Frog   135 KADLASKRAVDFQEAQAYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKTEPQAGGSNTIRGRG 199

  Fly   208 ---TETNRPT-NNCC 218
               |||.:|| :.||
 Frog   200 VDLTETAQPTKSQCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 133/161 (83%)
rab5aNP_001008068.1 Rab5_related 21..183 CDD:206653 133/161 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 275 1.000 Domainoid score I1722
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 309 1.000 Inparanoid score I2563
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm48913
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.