DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab5 and kras

DIOPT Version :9

Sequence 1:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001008034.1 Gene:kras / 493396 XenbaseID:XB-GENE-6036229 Length:186 Species:Xenopus tropicalis


Alignment Length:166 Identity:52/166 - (31%)
Similarity:97/166 - (58%) Gaps:3/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHS 93
            ::|||::|...||||:|.::.::..|.:..:.||..::..|.: |:......:|.||||||.|.:
 Frog     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDILDTAGQEEYSA 66

  Fly    94 LAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHK-QASPNIVIALAGNKADLSNIRVVEFDEA 157
            :...|.|..:..:.|:.|.|..||:....:.::::: :.|.::.:.|.|||.||.: |.|:..:|
 Frog    67 MRDQYMRTGEGFLCVFAINNTKSFEDVHHYREQINRVKDSDDVPMVLVGNKCDLPS-RTVDTKQA 130

  Fly   158 KQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKN 193
            ::.|:..|:.|:||||||...|.|.|..:.:::.|:
 Frog   131 QELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRKH 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 51/162 (31%)
krasNP_001008034.1 H_N_K_Ras_like 3..164 CDD:133338 51/162 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.